Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PF4 (Human) Recombinant proteinBioActive

  • Catalog # : P6133
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PF4 (P02776) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 7.8
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is <0.1 ng/ug of protein (<1 EU/ug).
  • Activity:
  • Determined by its ability to chemoattract human fibroblasts using a concentration range of 1.0-10.0 ng/mL.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 10mM Sodium Phosphate, pH 7.5.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 5196
  • Gene Name:
  • PF4
  • Gene Alias:
  • CXCL4,MGC138298,SCYB4
  • Gene Description:
  • platelet factor 4
  • Gene Summary:
  • Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. As a strong chemoattractant for neutrophils and fibroblasts, PF4 probably has a role in inflammation and wound repair (Eisman et al., 1990 [PubMed 1695112]).[supplied by OMIM
  • Other Designations:
  • chemokine (C-X-C motif) ligand 4,platelet factor 4 (chemokine (C-X-C motif) ligand 4)
  • RSS
  • YouTube
  • Linkedin
  • Facebook