Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PSPN (Human) Recombinant proteinBioActive

  • Catalog # : P6132
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PSPN (homodimer) (O60542) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • RALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG
  • Host:
  • Escherichia coli
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is <0.1 ng/ug of protein (<1 EU/ug).
  • Activity:
  • Human Persephin induces RET phosphorylation using a concentration range of 0.1-1.0 ng/mL. Human Persephin binds to mammalian GFRa4 with the Kd of 100pM. Other members of the GDNF family (Artemin, GDNF and Neurturin) do not bind to mammalian GFRa4.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 0.3x PBS, pH 7.2.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in 5 mM Sodium Phosphate, pH 7.5 to a concentration of <= 0.5 mg/mL. Do not vortex.
    For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 5623
  • Gene Name:
  • PSPN
  • Gene Alias:
  • PSP
  • Gene Description:
  • persephin
  • Gene Summary:
  • The protein encoded by this gene is a neurotrophic factor, belonging to the GDNF family. Neurotrophic factors are important for the proper development and maintenance of the nervous system. These factors promote neuronal survival and can prevent the neuronal degeneration associated with injury, toxin exposure, or neurodegenerative disease. The encoded protein has amino acid similarity to its other family members, glial cell line-derived neurotrophic factor and neurturin. This gene product promotes the survival of ventral midbrain dopaminergic neurons in culture and prevents their degeneration after 6-hydroxydopamine treatment in vivo. [provided by RefSeq
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook