Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF11B (Human) Recombinant proteinBioActive

  • Catalog # : P6124
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFRSF11B (O00300) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • METFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQK
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 20.0
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is <0.1 ng/ug of protein (<1 EU/ug).
  • Activity:
  • Determined by its ability to neutralize the stimulation of U937 cells treated with 10 ng/mL of soluble RANKL (sRANKL).
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 10 mM Tris (pH 7.5, 75 mM NaCl).
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in 5 mM Tris, pH 7.5 to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 4982
  • Gene Name:
  • TNFRSF11B
  • Gene Alias:
  • MGC29565,OCIF,OPG,TR1
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 11b
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand, both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest that this protein and its ligand play a role in lymph-node organogenesis and vascular calcification. Alternatively spliced transcript variants of this gene have been reported, but their full length nature has not been determined. [provided by RefSeq
  • Other Designations:
  • osteoclastogenesis inhibitory factor,osteoprotegerin
  • RSS
  • YouTube
  • Linkedin
  • Facebook