Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DEFA1 (Human) Recombinant proteinBioActive

  • Catalog # : P6122
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DEFA1 (P59665) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • ACYCRIPACIAGERRYGYCIYQGRLWAFCC
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 3.4
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is <0.1 ng/ug of protein (<1 EU/ug).
  • Activity:
  • Determined by its ability to chemoattract immature dendritic cells using a concentration of 1.0-10.0 ng/mL.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 1667
  • Gene Name:
  • DEFA1
  • Gene Alias:
  • DEF1,DEFA2,HNP-1,HP-1,MGC138393,MRS
  • Gene Description:
  • defensin, alpha 1
  • Gene Summary:
  • Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. It differs from defensin, alpha 3 by only one amino acid. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000196017,defensin, alpha 1, myeloid-related sequence,defensin, alpha 2,myeloid-related sequence
  • RSS
  • YouTube
  • Linkedin
  • Facebook