Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NOV (Human) Recombinant proteinBioActive

  • Catalog # : P6121
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NOV (P48745) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 36.2
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 95%
  • Endotoxin Level:
  • Endotoxin level is <0.1 ng/ug of protein (<1 EU/ug).
  • Activity:
  • Determined by a cell proliferation assay using BALB/c 3T3 cells. The expected ED50 for this effect is 1.0-2.0 ug/mL
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 10 mM Sodium Phosphate, pH 7.5.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 4856
  • Gene Name:
  • NOV
  • Gene Alias:
  • CCN3,IGFBP9
  • Gene Description:
  • nephroblastoma overexpressed gene
  • Gene Summary:
  • The protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development. [provided by RefSeq
  • Other Designations:
  • nephroblastoma overexpressed
  • RSS
  • YouTube
  • Linkedin
  • Facebook