Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NRN1 (Human) Recombinant proteinBioActive

  • Catalog # : P6116
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NRN1 (homodimer) (Q9NPD7) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • AGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 9.72
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is <0.1 ng/ug of protein (<1 EU/ug).
  • Activity:
  • Determined by a cell proliferation using rat C6 cells. The ED50 for this effect is 20.0-30.0 ng/mL.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 10 mM Sodium Citrate, pH 4.0.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • NRN1
  • Gene Alias:
  • MGC44811,NRN,dJ380B8.2
  • Gene Description:
  • neuritin 1
  • Gene Summary:
  • This gene is expressed in postmitotic-differentiating neurons of the developmental nervous system and neuronal structures associated with plasticity in the adult. The expression of this gene can be induced by neural activity and neurotrophins. The encoded protein contains a consensus cleavage signal found in glycosylphoshatidylinositol (GPI)-anchored proteins. In vitro assays demonstrated that this protein promotes neurite outgrowth and arborization, suggesting its role in promoting neuritogenesis. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000015989,neuritin
  • RSS
  • YouTube
  • Linkedin
  • Facebook