Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MMP3 (Human) Recombinant proteinBioActive

  • Catalog # : P6114
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MMP3 (P08254) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 42.8
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is <0.1 ng/ug of protein (<1 EU/ug).
  • Activity:
  • MMP3 activity was measured by its ability to cleave a chromogenic peptide MMP3 substrate at room temperature. At a MMP3 concentration of 2.5 ug/mL, 50% cleavage was achieved at an incubation time of approximately 75 minutes.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 10 mM Sodium Phosphate( pH 7.5, 0.1% CHAPS and 0.1 mM Calcium Chloride).
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.5-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 4314
  • Gene Name:
  • MMP3
  • Gene Alias:
  • CHDS6,MGC126102,MGC126103,MGC126104,MMP-3,SL-1,STMY,STMY1,STR1
  • Gene Description:
  • matrix metallopeptidase 3 (stromelysin 1, progelatinase)
  • Gene Summary:
  • Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes an enzyme which degrades fibronectin, laminin, collagens III, IV, IX, and X, and cartilage proteoglycans. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. [provided by RefSeq
  • Other Designations:
  • matrix metalloproteinase 3,matrix metalloproteinase 3 (stromelysin 1, progelatinase),progelatinase,proteoglycanase,stromelysin 1,transin-1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook