Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LIN28 (Human) Recombinant ProteinBioActive

  • Catalog # : P6110
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LIN28 (Q9H9Z2) full-length recombinant protein expressed in E. coli.
  • Sequence:
  • GPSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGP
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 24.4
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • E. coli expression system
  • Purity:
  • 90%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • Measured by its ability to induce fluorescence in Lin28 reporter cells (293 cells transfected with fluorescent protein genes under Lin28 control). Optimum activity was achieved at 20 ug/ml after incubation for 72 hr.
  • Recommend Usage:
  • SDS-PAGE
    Activity assay
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 10mM Sodium Citrate, pH 3.0.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • LIN28
  • Gene Alias:
  • CSDD1,FLJ12457,LIN-28,LIN28A,ZCCHC1
  • Gene Description:
  • lin-28 homolog (C. elegans)
  • Other Designations:
  • OTTHUMP00000003663,RNA-binding protein LIN-28,lin-28 homolog,zinc finger, CCHC domain containing 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook