Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL3L3 (Human) Recombinant ProteinBioActive

  • Catalog # : P6108
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL3L3 (P16619) partial recombinant protein expressed in E. coli.
  • Sequence:
  • APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 7.7
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • E. coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • Determined by its chemoattractivity with human monocytes at the range of 1.0-10.0 ng/ml.
  • Recommend Usage:
  • SDS-PAGE
    Activity assay
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • CCL3L3
  • Gene Alias:
  • 464.2,D17S1718,LD78,LD78BETA,MGC12815,SCYA3L,SCYA3L1
  • Gene Description:
  • chemokine (C-C motif) ligand 3-like 3
  • Gene Summary:
  • This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. This protein binds to several chemokine receptors including chemokine binding protein 2 and chemokine (C-C motif) receptor 5 (CCR5). CCR5 is a co-receptor for HIV, and binding of this protein to CCR5 inhibits HIV entry. The copy number of this gene varies among individuals; most individuals have 1-6 copies in the diploid genome, although rare individuals have zero or more than six copies. The human genome reference assembly contains two full copies of the gene and a partial pseudogene. This record represents the more centromeric full-length gene. [provided by RefSeq
  • Other Designations:
  • G0S19-2,chemokine (C-C motif) ligand 3-like, centromeric,small inducible cytokine A3-like 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook