Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL4L2 (Human) Recombinant ProteinBioActive

  • Catalog # : P6107
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL4L2 (P13236) partial recombinant protein expressed in E. coli.
  • Sequence:
  • APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 7.7
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • E. coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • Determined by its chemoattractivity with CCR5-transfected cells at 0.1-10.0 ng/ml
  • Recommend Usage:
  • SDS-PAGE
    Activity assay
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • CCL4L2
  • Gene Alias:
  • AT744.2,CCL4L,SCYA4L
  • Gene Description:
  • chemokine (C-C motif) ligand 4-like 2
  • Gene Summary:
  • This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. This protein is similar to CCL4 which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals; most individuals have 1-5 copies in the diploid genome, although rare individuals do not contain this gene at all. The human genome reference assembly contains two copies of this gene. This record represents the more telomeric gene. [provided by RefSeq
  • Other Designations:
  • CC chemokine ligand 4L1,CC chemokine ligand 4L1d2,CC chemokine ligand 4L2,chemokine (C-C motif) ligand 4-like 1, telomeric,lymphocyte activation gene 1,macrophage inflammatory protein-1b2,small inducible cytokine 4-like,small inducible cytokine A4-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook