Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL1F9 (Human) Recombinant ProteinBioActive

  • Catalog # : P6099
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL1F9 (Q9NZH8) partial recombinant protein expressed in E. coli.
  • Sequence:
  • SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 17.0
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • E. coli expression system
  • Purity:
  • 95%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • Measured by its ability to induce IL-8 production of human PBMCs.
  • Recommend Usage:
  • SDS-PAGE
    Activity assay
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 10mM Sodium Phosphate, pH 7.0 and 50mM NaCl.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • IL1F9
  • Gene Alias:
  • IL-1F9,IL-1H1,IL-1RP2,IL1E,IL1H1,IL1RP2
  • Gene Description:
  • interleukin 1 family, member 9
  • Gene Summary:
  • The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq
  • Other Designations:
  • IL-1 related protein 2,IL-1(EPSILON),IL-1-epsilon,interleukin 1-related protein 2,interleukin-1 epsilon,interleukin-1 homolog 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook