Product Browser

Last updated: 2017/8/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL1F8 (Human) Recombinant ProteinBioActive

  • Catalog # : P6098
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL1F8 (Q9NZH7) full-length recombinant protein expressed in E. coli.
  • Sequence:
  • MREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 17.3
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • E. coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • Measured by its ability to induce IL-8 production of human PBMCs.
  • Recommend Usage:
  • SDS-PAGE
    Activity assay
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 10mM Sodium Phosphate, pH 7.0.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • IL1F8
  • Gene Alias:
  • FIL1,FIL1-(ETA),FIL1H,IL-1F8,IL-1H2,IL1-ETA,IL1H2,MGC126880,MGC126882
  • Gene Description:
  • interleukin 1 family, member 8 (eta)
  • Gene Summary:
  • The protein encoded by this gene is a member of the interleukin 1 cytokine family. Protein structure modeling indicated that this cytokine may contain a 12-stranded beta-trefoil structure that is conserved between IL1A (IL-A alpha) and IL1B (IL-1 beta). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • IL-1F8 (FIL1-eta),IL1F8 (Canonical product IL-1F8a),Interleukin-1 Superfamily e,family of interleukin 1-eta,interleukin 1 family, member 8,interleukin 1, eta,interleukin-1 homolog 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook