Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Il1f5 (Mouse) Recombinant ProteinBioActive

  • Catalog # : P6097
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Il1f5 (Q9QYY1) full-length recombinant protein expressed in E. coli.
  • Sequence:
  • VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 17.0
  • Reactivity:
  • Mouse
  • Form:
  • Lyophilized
  • Preparation Method:
  • E. coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • Measured by its ability to inhibit IL-36gamma-induced IL-6 production of human PBMCs.
  • Recommend Usage:
  • SDS-PAGE
    Activity assay
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 10mM Sodium Phosphate, pH 7.5.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Il1f5
  • Gene Alias:
  • AI413231,FIL1delta,IL-1H3,IL1HY1
  • Gene Description:
  • interleukin 1 family, member 5 (delta)
  • Other Designations:
  • interleukin 1 family, member 5,interleukin 1 receptor antagonist homolog 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook