Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL24 (Human) Recombinant Protein

  • Catalog # : P6094
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL24 (Q13007) partial recombinant protein with C-terminal His-tag expressed in CHO cell.
  • Sequence:
  • QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKLHHHHHH
  • Host:
  • Hamster
  • Theoretical MW (kDa):
  • 18.9
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • CHO cell expression system
  • Purity:
  • 95%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Recommend Usage:
  • SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 10mM Sodium Phosphate, pH 7.5.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • IL24
  • Gene Alias:
  • C49A,FISP,IL-24,IL10B,MDA7,Mob-5,ST16,mda-7
  • Gene Description:
  • interleukin 24
  • Gene Summary:
  • This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • IL-24 splice variant delE3,IL-24 splice variant delE5,OTTHUMP00000034620,melanoma differentiation association protein 7,suppression of tumorigenicity 16 (melanoma differentiation)
  • RSS
  • YouTube
  • Linkedin
  • Facebook