Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL23 (Human) Recombinant ProteinBioActive

  • Catalog # : P6093
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL23 heterodimeric recombinant protein is composed of p19 (170 amino acids) subunit and p40 (306 amino acids) subunit expressed in Hi-5 (BTI-Tn-5B1-4) Insect cells.
  • Sequence:
  • RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSPIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
  • Host:
  • Insect
  • Theoretical MW (kDa):
  • 53.5
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Insect cell (Hi-5) expression system
  • Purity:
  • 95%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • Measured by its ability to induce IL-17 secretion of mouse splenocytes.
  • Recommend Usage:
  • SDS-PAGE
    Activity assay
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 1 x PBS, pH 7.2.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Protein Accession#:
  • Q9NPF7;P29460
  • Gene Name:
  • IL23A
  • Gene Alias:
  • IL-23,IL-23A,IL23P19,MGC79388,P19,SGRF
  • Gene Description:
  • interleukin 23, alpha subunit p19
  • Gene Summary:
  • This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells. [provided by RefSeq
  • Other Designations:
  • JKA3 induced upon T-cell activation,interleukin 23 p19 subunit
  • Gene Information
  • Entrez GeneID:
  • 3593
  • Protein Accession#:
  • Q9NPF7;P29460
  • Gene Name:
  • IL12B
  • Gene Alias:
  • CLMF,CLMF2,IL-12B,NKSF,NKSF2
  • Gene Description:
  • interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40)
  • Gene Summary:
  • This gene encodes a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. Interleukin 12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit encoded by this gene, and a 35 kD subunit encoded by IL12A. This cytokine is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. This cytokine has been found to be important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen. Overexpression of this gene was observed in the central nervous system of patients with multiple sclerosis (MS), suggesting a role of this cytokine in the pathogenesis of the disease. The promoter polymorphism of this gene has been reported to be associated with the severity of atopic and non-atopic asthma in children. [provided by RefSeq
  • Other Designations:
  • IL12, subunit p40,OTTHUMP00000160820,cytotoxic lymphocyte maturation factor 2, p40,interleukin 12, p40,interleukin 12B,interleukin-12 beta chain,natural killer cell stimulatory factor, 40 kD subunit,natural killer cell stimulatory factor-2
  • RSS
  • YouTube
  • Linkedin
  • Facebook