Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL13 (Human) Recombinant ProteinBioActive

  • Catalog # : P6089
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL13 (P35225) partial recombinant protein expressed in E. coli.
    This variant of IL-13, a mature 114 amino acid protein with a substitution of Q for R at position 112, shows enhanced functional activity compared with wild type IL-13.
  • Sequence:
  • MSPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
  • Host:
  • Escherichia coli
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • E. coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • This IL-13 analog, with a substitution of Q for R at position 112, measured by the in vitro dose dependent activation of STAT6 and IL-13 dependent gene induction in transfected A201.1 cells. This analog has also been shown to exhibit increased in vivo activity compared to wild type IL-13, as measured by the induction of airway hyper-responsiveness.
  • Recommend Usage:
  • SDS-PAGE
    Activity assay
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 10mM HCl.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.5-1.0 mg/mL. Do not vortex.
    Note: Allow the reconstituted vial to sit at 4°C for more than 2 hours before use.
    For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3596
  • Gene Name:
  • IL13
  • Gene Alias:
  • ALRH,BHR1,IL-13,MGC116786,MGC116788,MGC116789,P600
  • Gene Description:
  • interleukin 13
  • Gene Summary:
  • This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. [provided by RefSeq
  • Other Designations:
  • -
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook