Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Il13 (Rat) Recombinant ProteinBioActive

  • Catalog # : P6086
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rat Il13 (P42203) partial recombinant protein expressed in E. coli.
  • Sequence:
  • VRRSTSPPVALRELIEELSNITQDQKTSLCNSSIVWSVDITAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 11.9
  • Reactivity:
  • Rat
  • Form:
  • Lyophilized
  • Preparation Method:
  • E. coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • The ED50 determined by the dose-dependant stimulation of the proliferation of human TF-1 cells is < 40 ng/ml, corresponding to a specific activity of > 2.5 x 104 units/mg.
  • Recommend Usage:
  • SDS-PAGE
    Activity assay
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Il13
  • Gene Alias:
  • -
  • Gene Description:
  • interleukin 13
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook