Product Browser

Last updated: 2017/7/16

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Il12a (Mouse) Recombinant ProteinBioActive

  • Catalog # : P6085
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Il12a (P43431) full-length recombinant protein expressed in CHO cell.
  • Sequence:
  • p35Subunit:
    RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA
    p40Subunit:
    MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
  • Host:
  • Hamster
  • Reactivity:
  • Mouse
  • Form:
  • Lyophilized
  • Preparation Method:
  • CHO cell expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • Assay 1:
    The ED50 determined by the stimulation of IFN-gamma production with murine splenocytes co-stimulated with IL-18 is < 0.1 ng/ml, corresponding to a specific activity of > 1 x 107 units/mg.
    Assay 2:
    The activity is determined by its ability to stimulate the proliferation of 2D6 cells. The expected ED50 is < 0.1ng/ml, corresponding to a specific activity of > 1 x 107 units/mg.
  • Recommend Usage:
  • SDS-PAGE
    Activity assay
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 1 x PBS, pH 7.2.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in 1x PBS, pH 7.2-7.4 to a concentration of 0.1-1.0 mg/ml. Do not vortex.
    For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Il12a
  • Gene Alias:
  • IL-12p35,Il-12a,Ll12a,MGC151228,MGC151232,p35
  • Gene Description:
  • interleukin 12a
  • Other Designations:
  • interleukin 12a p35 subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook