Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IGF2 (Human) Recombinant ProteinBioActive

  • Catalog # : P6082
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IGF2 (P01344) partial recombinant protein expressed in E. coli.
  • Sequence:
  • AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
  • Host:
  • Escherichia coli
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • E. coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • The ED50 determined by a cell proliferation assay using FDC-P1 cells is < 2.0 ng/ml, corresponding to a specific activity of > 5 x 105 units/mg.
  • Recommend Usage:
  • SDS-PAGE
    Activity assay
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3481
  • Gene Name:
  • IGF2
  • Gene Alias:
  • C11orf43,FLJ22066,FLJ44734,INSIGF,pp9974
  • Gene Description:
  • insulin-like growth factor 2 (somatomedin A)
  • Gene Summary:
  • This gene encodes a member of the insulin family of polypeptide growth factors that is involved in development and growth. It is an imprinted gene and is expressed only from the paternally inherited allele. It is a candidate gene for eating disorders. There is a read-through, INS-IGF2, which aligns to this gene at the 3' region and to the upstream INS gene at the 5' region. Alternatively spliced transcript variants, encoding either the same or different isoform, have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000011012,OTTHUMP00000011015,OTTHUMP00000011018,OTTHUMP00000011157,insulin-like growth factor 2,insulin-like growth factor II,insulin-like growth factor type 2,putative insulin-like growth factor II associated protein,somatomedin A
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook