Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IGFBP6 (Human) Recombinant ProteinBioActive

  • Catalog # : P6080
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IGFBP6 (P24592) partial recombinant protein expressed in Hi-5 (BTI-Tn-5B1-4) Insect cells.
  • Sequence:
  • RCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
  • Host:
  • Insect
  • Theoretical MW (kDa):
  • 22.6
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Insect cell (Hi-5) expression system
  • Purity:
  • 95%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • Determined by its ability to inhibit IGF-II induced proliferation of human MCF-7 cells. The expected ED50 for this effect is 0.1-0.4ug/ml.
  • Recommend Usage:
  • SDS-PAGE
    Activity assay
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 10mM Sodium Citrate, pH 3.5.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3489
  • Gene Name:
  • IGFBP6
  • Gene Alias:
  • IBP6
  • Gene Description:
  • insulin-like growth factor binding protein 6
  • Other Designations:
  • IGF binding protein 6
  • RSS
  • YouTube
  • Linkedin
  • Facebook