Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GDF15 (Human) Recombinant ProteinBioActive

  • Catalog # : P6078
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GDF15 (Q99988) partial recombinant protein expressed in CHO cell.
  • Sequence:
  • ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
  • Host:
  • Hamster
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • CHO cell expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • Determined by a cell inhibition assay using DU-145 cells. The expected ED50 for this effect is 1.0-2.0 ug/ml.
  • Recommend Usage:
  • SDS-PAGE
    Activity assay
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 10mM Sodium Citrate, pH 3.0.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 9518
  • Gene Name:
  • GDF15
  • Gene Alias:
  • GDF-15,MIC-1,MIC1,NAG-1,PDF,PLAB,PTGFB
  • Gene Description:
  • growth differentiation factor 15
  • Gene Summary:
  • Bone morphogenetic proteins (e.g., BMP5; MIM 112265) are members of the transforming growth factor-beta (see TGFB1; MIM 190180) superfamily and regulate tissue differentiation and maintenance. They are synthesized as precursor molecules that are processed at a dibasic cleavage site to release C-terminal domains containing a characteristic motif of 7 conserved cysteines in the mature protein.[supplied by OMIM
  • Other Designations:
  • NSAID (nonsteroidal anti-inflammatory drug)-activated protein 1,PTGF-beta,prostate differentiation factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook