Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Ccl27a (Mouse) Recombinant ProteinBioActive

  • Catalog # : P6076
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Ccl27a (Q9Z1X0) full-length recombinant protein expressed in E. coli.
  • Sequence:
  • LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSNPQQQN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 10.9
  • Reactivity:
  • Mouse
  • Form:
  • Lyophilized
  • Preparation Method:
  • E. coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • Determined by its ability to chemoattract human peripheral blood lymphocytes using a concentration range of 10.0-100.0 ng/ml.
  • Recommend Usage:
  • SDS-PAGE
    Activity assay
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Ccl27a
  • Gene Alias:
  • ALP,AW558992,CTACK,CTAK,Ccl27,Ccl27b,ESkine,ILC,MGC130150,PESKY,Scya27,Scya27a,Scya27b,mILC
  • Gene Description:
  • chemokine (C-C motif) ligand 27A
  • Other Designations:
  • OTTMUSP00000007096,OTTMUSP00000007097,chemokine (C-C motif) ligand 27,chemokine (C-C motif) ligand 27b,skinkine,skinskine,small inducible cytokine A27,small inducible cytokine A27a,small inducible cytokine A27b
  • RSS
  • YouTube
  • Linkedin
  • Facebook