Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Ccl4 (Rat) Recombinant ProteinBioActive

  • Catalog # : P6069
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rat Ccl4 (P50230) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • APIGSDPPTSCCFSYTSRKIHRNFVMDYYETSSLCSQPAVVFLTKKGRQICADPSEPWVNEYVNDLELN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 7.8
  • Reactivity:
  • Human, Rat
  • Form:
  • Lyophlized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
  • Activity:
  • Determined by its ability to chemoattract human monocytes using a concentration range of 0.01-1.0 ug/ml.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 5 mM Sodium Phosphate (pH 7.0, 0.1 mM Calcium Chloride).
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.5-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Ccl4
  • Gene Alias:
  • Mip1-b,Scya4
  • Gene Description:
  • chemokine (C-C motif) ligand 4
  • Other Designations:
  • macrophage inflammatory protein-1 beta,small inducible cytokine A4
  • RSS
  • YouTube
  • Linkedin
  • Facebook