Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MIF (Human) Recombinant ProteinBioActive

  • Catalog # : P6067
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MIF (P14174) partial recombinant protein expressed in Hi-5.
  • Sequence:
  • HHHHHHHHAMPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
  • Host:
  • Insect
  • Theoretical MW (kDa):
  • 15
  • Reactivity:
  • Human
  • Form:
  • Lyophlized
  • Preparation Method:
  • Insect cell (Hi-5) expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
  • Activity:
  • Determined by its ability to inhibit monocyte migration.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 4282
  • Gene Name:
  • MIF
  • Gene Alias:
  • GIF,GLIF,MMIF
  • Gene Description:
  • macrophage migration inhibitory factor (glycosylation-inhibiting factor)
  • Gene Summary:
  • This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq
  • Other Designations:
  • glycosylation-inhibiting factor,phenylpyruvate tautomerase
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook