Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL22 (Human) Recombinant ProteinBioActive

  • Catalog # : P6062
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL22 (O00626) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 8.1
  • Reactivity:
  • Hamster, Human, Mouse
  • Form:
  • Lyophlized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
  • Activity:
  • Determined by its ability to chemoattract human T cells using a concentration range of 10.0-100.0 ng/ml.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 5 mM Sodium Phosphate, pH 7.5.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6367
  • Gene Name:
  • CCL22
  • Gene Alias:
  • A-152E5.1,ABCD-1,DC/B-CK,MDC,MGC34554,SCYA22,STCP-1
  • Gene Description:
  • chemokine (C-C motif) ligand 22
  • Gene Summary:
  • This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, dendritic cells, natural killer cells and for chronically activated T lymphocytes. It also displays a mild activity for primary activated T lymphocytes and has no chemoattractant activity for neutrophils, eosinophils and resting T lymphocytes. The product of this gene binds to chemokine receptor CCR4. This chemokine may play a role in the trafficking of activated T lymphocytes to inflammatory sites and other aspects of activated T lymphocyte physiology. [provided by RefSeq
  • Other Designations:
  • CC chemokine STCP-1,macrophage-derived chemokine,small inducible cytokine A22,small inducible cytokine subfamily A (Cys-Cys), member 22,stimulated T cell chemotactic protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook