Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Csf1 (Rat) Recombinant ProteinBioActive

  • Catalog # : P6060
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rat Csf1 (homodimer) (Q8JZQ0) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVVTKP
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 18.1
  • Reactivity:
  • Mouse, Rat
  • Form:
  • Lyophlized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
  • Activity:
  • The ED50 was determined by the dose-dependent stimulation of the proliferation of murine M-NFS-60 cells is <= 5.0 ng/ml, corresponding to a specific activity of >= 2 x 105 units/mg.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 20 mM Tris (pH 9.0, 0.1 mM Calcium Chloride and 100 mM Arginine).
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.5-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • RSS
  • YouTube
  • Linkedin
  • Facebook