Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFSF15 (Human) Recombinant ProteinBioActive

  • Catalog # : P6040
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFSF15 (O95150) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • QLRAQGEASVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 22.0
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • Determined by its ability to stimulate IFNG production by human PBMC using a concentration range of 10.0-100.0 ng/mL. Note: Results may vary with PBMC donors.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from sterile 10 mM Tris, pH 8.5 containing 75 mM Arginine
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 9966
  • Gene Name:
  • TNFSF15
  • Gene Alias:
  • MGC129934,MGC129935,TL1,TL1A,VEGI,VEGI192A
  • Gene Description:
  • tumor necrosis factor (ligand) superfamily, member 15
  • Gene Summary:
  • The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. An additional isoform encoded by an alternatively spliced transcript variant has been reported but the sequence of this transcript has not been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022739,TNF ligand-related molecule 1,TNF superfamily ligand TL1A,vascular endothelial cell growth inhibitor,vascular endothelial growth inhibitor-192A
  • RSS
  • YouTube
  • Linkedin
  • Facebook