Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TIMP2 (Human) Recombinant ProteinBioActive

  • Catalog # : P6039
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TIMP2 (P16035) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 21.8
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 95%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • TIMP2 activity was measured by its ability to inhibit human MMP1 induced hydrolysis of a chromogenic peptide substrate at room temperature. Half maximal inhibition was obtained at a TIMP2 concentration of approximately 0.5 ug/mL, when using an MMP1 concentration of 1.6 ug/mL.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from sterile 10 mM Sodium Phosphate, pH 7.5
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7077
  • Gene Name:
  • TIMP2
  • Gene Alias:
  • CSC-21K
  • Gene Description:
  • TIMP metallopeptidase inhibitor 2
  • Gene Summary:
  • This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix. [provided by RefSeq
  • Other Designations:
  • tissue inhibitor of metalloproteinase 2,tissue inhibitor of metalloproteinases 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook