Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TIMP1 (Human) Recombinant ProteinBioActive

  • Catalog # : P6038
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TIMP1 (P01033) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 20.6
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 95%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • TIMP1 activity was measured by its ability to inhibit human MMP1 induced hydrolysis of a chromogenic peptide substrate at room temperature. Half maximal inhibition was obtained at a TIMP1 concentration of approximately 0.5 ug/mL, when using an MMP1 concentration of 1.6 ug/mL.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from sterile 10 mM Sodium Phosphate, pH 7.5
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7076
  • Gene Name:
  • TIMP1
  • Gene Alias:
  • CLGI,EPA,EPO,FLJ90373,HCI,TIMP
  • Gene Description:
  • TIMP metallopeptidase inhibitor 1
  • Gene Summary:
  • This gene belongs to the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases (MMPs), a group of peptidases involved in degradation of the extracellular matrix. In addition to its inhibitory role against most of the known MMPs, the encoded protein is able to promote cell proliferation in a wide range of cell types, and may also have an anti-apoptotic function. Transcription of this gene is highly inducible in response to many cytokines and hormones. In addition, the expression from some but not all inactive X chromosomes suggests that this gene inactivation is polymorphic in human females. This gene is located within intron 6 of the synapsin I gene and is transcribed in the opposite direction. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000023214,erythroid potentiating activity,fibroblast collagenase inhibitor,tissue inhibitor of metalloproteinase 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook