Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TMSB4X (Human) Recombinant ProteinBioActive

  • Catalog # : P6036
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TMSB4X (P62328) full-length recombinant protein expressed in Escherichia coli.
  • Sequence:
  • RMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 5.2
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 95%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • Pretreatment of primary lung fibroblasts with recombinant TMSB4X, using a concentration of 0.5-10 ug/mL, produces a protective effect against hydrogen peroxide induced cell death.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from sterile solution with no additives
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7114
  • Gene Name:
  • TMSB4X
  • Gene Alias:
  • FX,PTMB4,TB4X,TMSB4
  • Gene Description:
  • thymosin beta 4, X-linked
  • Gene Summary:
  • This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022925,OTTHUMP00000022926,OTTHUMP00000022927,OTTHUMP00000022928,prothymosin beta-4,thymosin beta-4,thymosin, beta 4,thymosin, beta 4, X chromosome
  • RSS
  • YouTube
  • Linkedin
  • Facebook