Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TGFB2 (Human) Recombinant ProteinBioActive

  • Catalog # : P6034
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TGFB2 (P61812) partial recombinant protein expressed in HEK293 cells.
  • Sequence:
  • ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 25.0
  • Reactivity:
  • Mouse, Rat
  • Form:
  • Lyophilized
  • Preparation Method:
  • Mammalian cell (HEK293) expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • Determined by its ability to inhibit the mouse IL-4-dependent proliferation of mouse HT-2 cells. The expected ED50 is <= 0.2 ng/mL, corresponding to a specific activity of >= 5 x 106 units/mg.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from sterile solution with no additives
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7042
  • Gene Name:
  • TGFB2
  • Gene Alias:
  • MGC116892,TGF-beta2
  • Gene Description:
  • transforming growth factor, beta 2
  • Other Designations:
  • OTTHUMP00000037528
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook