Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TGFB1 (Human) Recombinant ProteinBioActive

  • Catalog # : P6032
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TGFB1 (P01137) partial recombinant protein expressed in CHO cells.
  • Sequence:
  • ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
  • Host:
  • Hamster
  • Theoretical MW (kDa):
  • 25.0
  • Reactivity:
  • Bovine, Chicken, Dog, Frog, Monkey, Mouse, Pig, Rabbit, Rat
  • Form:
  • Lyophilized
  • Preparation Method:
  • Mammalian cell (CHO) expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • Determined by TGFB1's ability to inhibit the mouse IL-4-dependent proliferation of mouse HT-2 cells. The expected ED50 is <= 0.05 ng/mL, corresponding to a specific activity of >= 2 x 107 units/mg.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from sterile solution with no additives
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7040
  • Gene Name:
  • TGFB1
  • Gene Alias:
  • CED,DPD1,TGFB,TGFbeta
  • Gene Description:
  • transforming growth factor, beta 1
  • Gene Summary:
  • TGFB is a multifunctional peptide that controls proliferation, differentiation, and other functions in many cell types. TGFB acts synergistically with TGFA (MIM 190170) in inducing transformation. It also acts as a negative autocrine growth factor. Dysregulation of TGFB activation and signaling may result in apoptosis. Many cells synthesize TGFB and almost all of them have specific receptors for this peptide. TGFB1, TGFB2 (MIM 190220), and TGFB3 (MIM 190230) all function through the same receptor signaling systems.[supplied by OMIM
  • Other Designations:
  • TGF-beta 1 protein,diaphyseal dysplasia 1, progressive,transforming growth factor-beta 1
  • Interactome
  • Interactome
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook