Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TFF3 (Human) Recombinant ProteinBioActive

  • Catalog # : P6030
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TFF3 (Q07654) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 13.2
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • <0.1 ng/ug (<1 EU/ug)
  • Activity:
  • Determined by its ability to chemoattract human MCF-7 cells using a concentration range of 1.0-10.0 ug/mL.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from sterile solution with no additives
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7033
  • Gene Name:
  • TFF3
  • Gene Alias:
  • HITF,ITF,TFI,hP1.B
  • Gene Description:
  • trefoil factor 3 (intestinal)
  • Gene Summary:
  • Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. This gene is expressed in goblet cells of the intestines and colon. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq
  • Other Designations:
  • intestinal trefoil factor,secretory protein,trefoil factor 3,trefoil factor 3, HITF, human intestinal trefoil factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook