Product Browser

Last updated: 2017/5/28

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IFNB1 (Human) Recombinant ProteinBioActive

  • Catalog # : P6025
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IFNB1 (P01574) partial recombinant protein expressed in CHO cells.
  • Sequence:
  • MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
  • Host:
  • Hamster
  • Theoretical MW (kDa):
  • 22.3
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Mammalian cell (CHO) expression system
  • Purity:
  • 95%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug (< 1 EU/ug).
  • Activity:
  • Assay 1:
    Measured by its ability to induce apoptosis in HeLa cells. The expected ED50 for this effect is 20-30 ng/ml.
    Assay 2:
    Determined by its ability to stimulate the proliferation of human TF-1 cells. The expected ED50 is ≤ 0.1 ng/ml, corresponding to a specific activity of ≥ 1 x 107 units/mg.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3456
  • Gene Name:
  • IFNB1
  • Gene Alias:
  • IFB,IFF,IFNB,MGC96956
  • Gene Description:
  • interferon, beta 1, fibroblast
  • Other Designations:
  • OTTHUMP00000021131,interferon beta
  • RSS
  • YouTube
  • Linkedin
  • Facebook