Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL14 (Human) Recombinant ProteinBioActive

  • Catalog # : P6019
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL14 (Q16627) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 7.8
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug (< 1 EU/ug).
  • Activity:
  • Determined by its ability to chemoattract human monocytes using a concentration range of 5.0-20.0 ng/ml.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6358
  • Gene Name:
  • CCL14
  • Gene Alias:
  • CC-1,CC-3,CKb1,HCC-1,HCC-3,MCIF,NCC-2,NCC2,SCYA14,SCYL2,SY14
  • Gene Description:
  • chemokine (C-C motif) ligand 14
  • Gene Summary:
  • This gene, CCL14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene CCL15, and are represented as GeneID: 348249. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000176860,chemokine CC-1,chemokine CC-3,small inducible cytokine subfamily A (Cys-Cys), member 14
  • RSS
  • YouTube
  • Linkedin
  • Facebook