Product Browser

Last updated: 2017/7/16

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GDF5 (Human) Recombinant ProteinBioActive

  • Catalog # : P6010
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GDF5 (P43026) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • APSATRQGKRPSKNLKARCSRKALHVNFKAPSATRQGKRPSKNLKARCSRKALHVNFKDMGWDDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 27.0
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug (< 1 EU/ug).
  • Activity:
  • The ED50 was determined by its ability to induce alkaline phosphatase production by ATDC-5 chondrogenic cells is 1.0-2.0 ug/ml.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 8200
  • Gene Name:
  • GDF5
  • Gene Alias:
  • BMP14,CDMP1,LAP4,SYNS2
  • Gene Description:
  • growth differentiation factor 5
  • Gene Summary:
  • The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Mutations in this gene are associated with acromesomelic dysplasia, Hunter-Thompson type; brachydactyly, type C; and chondrodysplasia, Grebe type. These associations confirm that the gene product plays a role in skeletal development. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000030755,OTTHUMP00000061644,cartilage-derived morphogenetic protein-1
  • RSS
  • YouTube
  • Linkedin
  • Facebook