Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GDF11 (Human) Recombinant ProteinBioActive

  • Catalog # : P6006
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GDF11 (O95390) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 25.0
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug (< 1 EU/ug).
  • Activity:
  • The ED50 was determined by its ability to inhibit induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The expected ED50 for this effect is 0.08-0.10 ug/ml.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • GDF11
  • Gene Alias:
  • BMP-11,BMP11
  • Gene Description:
  • growth differentiation factor 11
  • Gene Summary:
  • The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in mice and Xenopus suggest that this protein is involved in mesodermal formation and neurogenesis during embryonic development. [provided by RefSeq
  • Other Designations:
  • bone morphogenetic protein 11
  • RSS
  • YouTube
  • Linkedin
  • Facebook