Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CXCL6 (Human) Recombinant ProteinBioActive

  • Catalog # : P6005
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CXCL6 (P80162) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 7.9
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug (< 1 EU/ug).
  • Activity:
  • Determined by its ability to chemoattract human neutrophils using a concentration range of 10.0-50.0 ng/ml.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6372
  • Gene Name:
  • CXCL6
  • Gene Alias:
  • CKA-3,GCP-2,GCP2,SCYB6
  • Gene Description:
  • chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2)
  • Other Designations:
  • Small inducible cytokine subfamily B (Cys-X-Cys), member b,small inducible cytokine subfamily B (Cys-X-Cys), member 6 (granulocyte chemotactic protein 2)
  • RSS
  • YouTube
  • Linkedin
  • Facebook