Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LGALS3 (Human) Recombinant ProteinBioActive

  • Catalog # : P6003
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LGALS3 (P17931) full length recombinant protein expressed in Escherichia coli.
  • Sequence:
  • ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 26.0
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug (< 1 EU/ug).
  • Activity:
  • Determined by its ability to chemoattract human blood monocytes. Chemotactic activity was observed at a concentration of 2.5 ug/ml with a peak response obtained at 250 ug/ml.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3958
  • Gene Name:
  • LGALS3
  • Gene Alias:
  • CBP35,GAL3,GALBP,GALIG,LGALS2,MAC2
  • Gene Description:
  • lectin, galactoside-binding, soluble, 3
  • Other Designations:
  • IgE-binding protein,MAC-2 antigen,carbohydrate-binding protein 35,galactose-specific lectin 3,galectin 3,galectin-3 internal,laminin-binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook