Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IGFBP1 (Human) Recombinant ProteinBioActive

  • Catalog # : P5987
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IGFBP1 (P08833) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 25.4
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
  • Activity:
  • The ED50 was determined by its ability to inhibit IGF-I induced proliferation of MCF-7 is ≤ 0.5 ug/mL in the presence of 6 ng/mL of human IGF-I.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3484
  • Gene Name:
  • IGFBP1
  • Gene Alias:
  • AFBP,IBP1,IGF-BP25,PP12,hIGFBP-1
  • Gene Description:
  • insulin-like growth factor binding protein 1
  • Gene Summary:
  • This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. [provided by RefSeq
  • Other Designations:
  • IGF-binding protein 1,alpha-pregnancy-associated endometrial globulin,amniotic fluid binding protein,binding protein-25,binding protein-26,binding protein-28,growth hormone independent-binding protein,placental protein 12
  • RSS
  • YouTube
  • Linkedin
  • Facebook