Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FGF10 (Human) Recombinant ProteinBioActive

  • Catalog # : P5982
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FGF10 (O15520) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MLGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 19.3
  • Reactivity:
  • Chicken, Human, Mouse
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 95%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
  • Activity:
  • The ED50 as determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF-receptors is ≤ 0.5 ng/mL, corresponding to a specific activity of ≥ 2 x 106 units/mg.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2255
  • Gene Name:
  • FGF10
  • Gene Alias:
  • -
  • Gene Description:
  • fibroblast growth factor 10
  • Gene Summary:
  • The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein exhibits mitogenic activity for keratinizing epidermal cells, but essentially no activity for fibroblasts, which is similar to the biological activity of FGF7. Studies of the mouse homolog of suggested that this gene is required for embryonic epidermal morphogenesis including brain development, lung morphogenesis, and initiation of lim bud formation. This gene is also implicated to be a primary factor in the process of wound healing. [provided by RefSeq
  • Other Designations:
  • keratinocyte growth factor 2,produced by fibroblasts of urinary bladder lamina propria
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook