Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CXCL5 (Human) Recombinant ProteinBioActive

  • Catalog # : P5973
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CXCL5 (P42830) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • LRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 7.8
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
  • Activity:
  • Determined by its ability to chemoattract human neutrophils using a concentration range of 10.0-100.0 ng/ml.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6374
  • Gene Name:
  • CXCL5
  • Gene Alias:
  • ENA-78,SCYB5
  • Gene Description:
  • chemokine (C-X-C motif) ligand 5
  • Gene Summary:
  • The protein encoded by this gene is an inflammatory chemokine that belongs to the CXC chemokine family. This chemokine is produced concomitantly with interleukin-8 (IL8) in response to stimulation with either interleukin-1 (IL1) or tumor necrosis factor-alpha (TNFA). This chemokine is a potent chemotaxin involved in neutrophil activation. [provided by RefSeq
  • Other Designations:
  • epithelial-derived neutrophil activating protein 78,epithelial-derived neutrophil-activating peptide 78,neutrophil-activating peptide ENA-78,neutrophil-activating protein 78,small inducible cytokine B5,small inducible cytokine subfamily B (Cys-X-Cys), mem
  • RSS
  • YouTube
  • Linkedin
  • Facebook