Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL27 (Human) Recombinant ProteinBioActive

  • Catalog # : P5964
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL27 (Q9Y4X3) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 10.2
  • Reactivity:
  • Human, Mouse
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
  • Activity:
  • Determined by its ability to chemoattract CXCR3 transfected cells using a concentration of 10.0-100.0 ng/mL.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • CCL27
  • Gene Alias:
  • ALP,CTACK,CTAK,ESKINE,ILC,PESKY,SCYA27
  • Gene Description:
  • chemokine (C-C motif) ligand 27
  • Gene Summary:
  • This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene is chemotactic for skin-associated memory T lymphocytes. This cytokine may also play a role in mediating homing of lymphocytes to cutaneous sites. It specifically binds to chemokine receptor 10 (CCR10). Studies of a similar murine protein indicate that these protein-receptor interactions have a pivotal role in T cell-mediated skin inflammation. [provided by RefSeq
  • Other Designations:
  • CC chemokine ILC,IL-11 Ralpha-locus chemokine,OTTHUMP00000000533,OTTHUMP00000021297,cutaneous T-cell attracting chemokine,skinkine,small inducible cytokine A27,small inducible cytokine subfamily A (Cys-Cys), member 27
  • RSS
  • YouTube
  • Linkedin
  • Facebook