Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CXCL14 (Human) Recombinant ProteinBioActive

  • Catalog # : P5959
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CXCL14 (O95715) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 9.4
  • Reactivity:
  • Human, Mouse
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
  • Activity:
  • Determined by it's ability to chemoattract activated monocytes using a concentration range of 1.0-10.0 ng/mL.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 9547
  • Gene Name:
  • CXCL14
  • Gene Alias:
  • BMAC,BRAK,KS1,Kec,MGC10687,MIP-2g,NJAC,SCYB14,bolekine
  • Gene Description:
  • chemokine (C-X-C motif) ligand 14
  • Gene Summary:
  • This gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation. [provided by RefSeq
  • Other Designations:
  • CXC chemokine in breast and kidney,small inducible cytokine B14,small inducible cytokine subfamily B (Cys-X-Cys), member 14 (BRAK)
  • RSS
  • YouTube
  • Linkedin
  • Facebook