Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Bmp4 (Mouse) Recombinant ProteinBioActive

  • Catalog # : P5958
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Bmp4 (P21275, 303 a.a. - 408 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • KKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
  • Host:
  • Escherichia coli
  • Reactivity:
  • Mouse
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
  • Activity:
  • Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 5-15 ng/ml.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in 10 mM Citric Acid to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Bmp4
  • Gene Alias:
  • Bmp2b,Bmp2b-1,Bmp2b1
  • Gene Description:
  • bone morphogenetic protein 4
  • Other Designations:
  • OTTMUSP00000021065,OTTMUSP00000021066
  • RSS
  • YouTube
  • Linkedin
  • Facebook