Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BMP10 (Human) Recombinant ProteinBioActive

  • Catalog # : P5953
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BMP10 (O95393, 317 a.a. - 424 a.a.) partial recombinant protein expressed in HEK293 cells.
  • Sequence:
  • NAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 24.4
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Mammalian cell (HEK293) expression system
  • Purity:
  • 95%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
  • Activity:
  • Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 4.0-6.0 ng/ml.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • BMP10
  • Gene Alias:
  • MGC126783
  • Gene Description:
  • bone morphogenetic protein 10
  • Gene Summary:
  • The protein encoded by this gene is a member of the TGF-beta family of growth factors. Data suggest that the similar protein in mouse plays an important role in trabeculation of the embryonic heart. In human, this protein may signal through receptor serine/threonine kinases. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000159973
  • RSS
  • YouTube
  • Linkedin
  • Facebook