Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BMP3 (Human) Recombinant ProteinBioActive

  • Catalog # : P5948
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BMP3 (P12645, 361 a.a. - 472 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
  • Host:
  • Escherichia coli
  • Reactivity:
  • Human, Mouse
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 95%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
  • Activity:
  • Determined by its ability to inhibit BMP-2-induced alkaline phosphatase production by ATDC-5 cells.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 651
  • Gene Name:
  • BMP3
  • Gene Alias:
  • BMP-3A
  • Gene Description:
  • bone morphogenetic protein 3
  • Gene Summary:
  • BMP3 belongs to the transforming growth factor-beta (TGFB) superfamily. Bone morphogenic protein, also known as osteogenin, induces bone formation. [provided by RefSeq
  • Other Designations:
  • bone morphogenetic protein 3 (osteogenic),bone morphogenetic protein-3,osteogenin
  • RSS
  • YouTube
  • Linkedin
  • Facebook