Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFSF13 (Human) Recombinant ProteinBioActive

  • Catalog # : P5947
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFSF13 (O75888) partial recombinant protein expressed in Hi-5 cells.
  • Sequence:
  • AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL
  • Host:
  • Insect
  • Theoretical MW (kDa):
  • 16.3
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Insect cell (Hi-5) expression system
  • Purity:
  • 95%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
  • Activity:
  • Measured by its ability to induce cell death in Jurkat cells.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 8741
  • Gene Name:
  • TNFSF13
  • Gene Alias:
  • APRIL,CD256,TALL2,TRDL-1,UNQ383/PRO715,ligand
  • Gene Description:
  • tumor necrosis factor (ligand) superfamily, member 13
  • Gene Summary:
  • The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. Other transcripts that skip the last exon of the upstream gene (TNFSF12) and continue with the second exon of this gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000174780,TNF- and APOL-related leukocyte expressed ligand 2,a proliferation inducing ligand,tumor necrosis factor (ligand) superfamily member 13 transcript variant delta,tumor necrosis factor ligand superfamily member 13 epsilon,tumor necrosis f
  • RSS
  • YouTube
  • Linkedin
  • Facebook