Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ANGPT2 (Human) Recombinant ProteinBioActive

  • Catalog # : P5940
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ANGPT2 (O15123) partial recombinant protein with His tag expressed in CHO cells.
  • Sequence:
  • DAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADFHHHHHH
  • Host:
  • Hamster
  • Theoretical MW (kDa):
  • 60-70
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Mammalian cell (CHO) expression system
  • Purity:
  • 95%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
  • Activity:
  • Determined by its ability to stimulate tubulogenesis in HUVEC cells using a concentration of 0.2 ug/ml
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 285
  • Gene Name:
  • ANGPT2
  • Gene Alias:
  • AGPT2,ANG2
  • Gene Description:
  • angiopoietin 2
  • Gene Summary:
  • The protein encoded by this gene is an antagonist of angiopoietin 1 (ANGPT1) and endothelial TEK tyrosine kinase (TIE-2, TEK). The encoded protein disrupts the vascular remodeling ability of ANGPT1 and may induce endothelial cell apoptosis. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • Tie2-ligand,angiopoietin-2,angiopoietin-2B,angiopoietin-2a
  • RSS
  • YouTube
  • Linkedin
  • Facebook