Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AREG (Human) Recombinant ProteinBioActive

  • Catalog # : P5938
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human AREG (P15514) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 11.3
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 95%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
  • Activity:
  • Determined by its ability to stimulate the proliferation of mouse Balb/c 3T3 cells. The expected ED50 for this effect is 5-10 ng/ml.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 374
  • Gene Name:
  • AREG
  • Gene Alias:
  • AR,CRDGF,MGC13647,SDGF
  • Gene Description:
  • amphiregulin
  • Gene Summary:
  • The protein encoded by this gene is a member of the epidermal growth factor family. It is an autocrine growth factor as well as a mitogen for astrocytes, Schwann cells, and fibroblasts. It is related to epidermal growth factor (EGF) and transforming growth factor alpha (TGF-alpha). This protein interacts with the EGF/TGF-alpha receptor to promote the growth of normal epithelial cells and inhibits the growth of certain aggressive carcinoma cell lines. This encoded protein is associated with a psoriasis-like skin phenotype. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000160473,colorectum cell-derived growth factor,schwannoma-derived growth factor
  • Interactome
  • Interactome
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook